PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_74469.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SRS
Protein Properties Length: 136aa    MW: 13853.2 Da    PI: 4.5158
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_74469.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70277.15e-2456594154
        DUF702  94 aeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                   ++s+      ++P+e+s eavfrcvr++ vd+ ++e+aYqtavsigGh+fkGiL+d+G++e
  MLOC_74469.2   5 TTSSAGEGDGRFPPELSLEAVFRCVRIGPVDEPDAEFAYQTAVSIGGHTFKGILRDHGPAE 65 
                   44555566677***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051428.1E-21964IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016243.4E-191563IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MVDATTSSAG EGDGRFPPEL SLEAVFRCVR IGPVDEPDAE FAYQTAVSIG GHTFKGILRD  60
HGPAEEAAGQ LPPSSAEYHQ LTGAAREGSS PAGSSEAAGG HGATVATSAA VLMDPYPTPI  120
GAFAAGTQFF PHNPRT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6783470.0AB678347.1 Hordeum vulgare subsp. vulgare Lks2 gene for putative short internodesfamily transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642175.15e-69PREDICTED: protein SHI RELATED SEQUENCE 1
RefseqXP_015693709.14e-69PREDICTED: protein SHI RELATED SEQUENCE 1, partial
TrEMBLM0YYJ71e-93M0YYJ7_HORVD; Uncharacterized protein
STRINGMLOC_74469.11e-89(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.18e-24Lateral root primordium (LRP) protein-related